P01116

PTMD Annotation Information

※ Protein Information

Tag	Content
UniProt Accession	RASK_HUMAN; P01116;
Entrez ID	3845
GenBank Protein ID	NM_004985.4; NM_033360.3; XM_006719069.3; XM_011520653.2;
GenBank Nucleotide ID	NP_004976.2; NP_203524.1; XP_006719132.1; XP_011518955.1;
Protein Name	GTPase KRas (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]
Gene Name	KRAS; KRAS2; RASK2
Organism	Homo sapiens
NCBI Taxa ID	9606
Functional Description	Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation (PubMed:23698361, PubMed:22711838). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (PubMed:24623306). Functional Description Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation (PubMed:23698361, PubMed:22711838). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (PubMed:24623306).
Sequence (Fasta)	MTEYKLVVVG AGGVGKSALT IQLIQNHFVD EYDPTIEDSY RKQVVIDGET CLLDILDTAG 60 QEEYSAMRDQ YMRTGEGFLC VFAINNTKSF EDIHHYREQI KRVKDSEDVP MVLVGNKCDL 120 PSRTVDTKQA QDLARSYGIP FIETSAKTRQ RVEDAFYTLV REIRQYRLKK ISKEEKTPGC 180 VKIKKCIIM Fasta Sequence >P01116\|KRAS; KRAS2; RASK2\|Homo sapiens (Human) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM

※ PTM-Disease Association

Num	PTM	Disease	Cell Type	Type	PTM Site	PMID
1	Serine Phosphorylation	Pancreatic cancer/carcinoma/adenocarcinoma		P	S181	24371225
1	[Reference]: Phosphorylation at Ser-181 of oncogenic KRAS is required for tumor growth

※ Disease Cross-ref Annotation

Database	Annotation
Cancer Gene Census	pancreatic, colorectal, lung, thyroid, AML, other tumour types
CTD (Curated) (count: 52) (view all)	MESH:D000230 ; Adenocarcinoma MESH:D018263 ; Adenocarcinoma, Follicular MESH:C538231 ; Adenocarcinoma of lung MESH:D000236 ; Adenoma MESH:D000740 ; Anemia MESH:D001171 ; Arthritis, Juvenile MESH:D001254 ; Astrocytoma MESH:D001943 ; Breast Neoplasms MESH:D063646 ; Carcinogenesis MESH:D002277 ; Carcinoma MESH:D006528 ; Carcinoma, Hepatocellular MESH:D021441 ; Carcinoma, Pancreatic Ductal MESH:D002294 ; Carcinoma, Squamous Cell MESH:C535579 ; Cardiofaciocutaneous syndrome MESH:D002430 ; Cecal Neoplasms MESH:D002471 ; Cell Transformation, Neoplastic MESH:D018281 ; Cholangiocarcinoma MESH:D003110 ; Colonic Neoplasms MESH:D015179 ; Colorectal Neoplasms MESH:D056685 ; Costello Syndrome MESH:D004195 ; Disease Models, Animal MESH:D004715 ; Endometriosis MESH:D005706 ; Gallbladder Neoplasms MESH:D006394 ; Hemangiosarcoma MESH:D015470 ; Leukemia, Myeloid, Acute MESH:D054429 ; Leukemia, Myelomonocytic, Juvenile MESH:D007964 ; Leukocytosis MESH:D008109 ; Liver Diseases, Parasitic MESH:D008113 ; Liver Neoplasms MESH:D008114 ; Liver Neoplasms, Experimental MESH:D008175 ; Lung Neoplasms MESH:D008223 ; Lymphoma MESH:D009062 ; Mouth Neoplasms MESH:D009190 ; Myelodysplastic Syndromes MESH:C538339 ; Nasopharyngeal carcinoma MESH:D009362 ; Neoplasm Metastasis MESH:D009369 ; Neoplasms MESH:D009374 ; Neoplasms, Experimental MESH:D009447 ; Neuroblastoma MESH:D054000 ; Nevus, Sebaceous of Jadassohn MESH:D002289 ; Carcinoma, Non-Small-Cell Lung MESH:D009634 ; Noonan Syndrome MESH:C537847 ; Noonan syndrome 3 MESH:D010051 ; Ovarian Neoplasms MESH:D010190 ; Pancreatic Neoplasms MESH:D010412 ; Penile Neoplasms MESH:D012008 ; Recurrence MESH:D013163 ; Splenomegaly MESH:D013274 ; Stomach Neoplasms MESH:D013964 ; Thyroid Neoplasms MESH:D001749 ; Urinary Bladder Neoplasms MESH:D014594 ; Uterine Neoplasms
DisGeNet (Curated) (count: 308) (view all)	C0000737; Abdominal Pain C0001418; Adenocarcinoma C0001430; Adenoma C0002170; Alopecia C0003467; Anxiety C0003492; Aortic coarctation C0003811; Cardiac Arrhythmia C0004114; Astrocytoma C0005695; Bladder Neoplasm C0005745; Blepharoptosis C0005779; Blood Coagulation Disorders C0007102; Malignant tumor of colon C0007117; Basal cell carcinoma C0007120; Bronchioloalveolar Adenocarcinoma C0007131; Non-Small Cell Lung Carcinoma C0007137; Squamous cell carcinoma C0007528; Cecal Neoplasms C0007621; Neoplastic Cell Transformation C0009363; Congenital ocular coloboma (disorder) C0009375; Colonic Neoplasms C0009404; Colorectal Neoplasms C0009806; Constipation C0010417; Cryptorchidism C0011581; Depressive disorder C0013362; Dysarthria C0014175; Endometriosis C0014544; Epilepsy C0015300; Exophthalmos C0015672; Fatigue C0016978; gallbladder neoplasm C0017154; Gastritis, Atrophic C0017181; Gastrointestinal Hemorrhage C0017636; Glioblastoma C0018817; Atrial Septal Defects C0018818; Ventricular Septal Defects C0018916; Hemangioma C0018920; Hemangioma, Cavernous C0018923; Hemangiosarcoma C0019087; Hemorrhagic Disorders C0019209; Hepatomegaly C0020534; Orbital separation excessive C0020757; Ichthyoses C0022596; Palmoplantar Keratosis C0023467; Leukemia, Myelocytic, Acute C0023897; Liver Diseases, Parasitic C0023903; Liver neoplasms C0023904; Liver Neoplasms, Experimental C0024121; Lung Neoplasms C0024299; Lymphoma C0025362; Mental Retardation C0025990; Micrognathism C0026010; Microphthalmos C0026267; Mitral Valve Prolapse Syndrome C0026640; Mouth Neoplasms C0026826; Muscle Hypertonia C0026827; Muscle hypotonia C0027092; Myopia C0027498; Nausea and vomiting C0027627; Neoplasm Metastasis C0027659; Neoplasms, Experimental C0027819; Neuroblastoma C0027962; Melanocytic nevus C0028326; Noonan Syndrome C0028738; Nystagmus C0029453; Osteopenia C0030297; Pancreatic Neoplasm C0030849; Penile Neoplasms C0034885; Rectal Neoplasms C0036572; Seizures C0036651; Senile lentigo C0037932; Curvature of spine C0038356; Stomach Neoplasms C0038379; Strabismus C0040136; Thyroid Neoplasm C0040427; Tooth Abnormalities C0042138; Uterine Neoplasms C0149931; Migraine Disorders C0151526; Premature Birth C0151611; Electroencephalogram abnormal C0151740; Intracranial Hypertension C0151786; Muscle Weakness C0151889; Hyperreflexia C0151908; Dry skin C0152013; Adenocarcinoma of lung (disorder) C0152421; Macrotia C0158731; Congenital pectus carinatum C0162835; Hypopigmentation disorder C0206620; Lymphangioma, Cystic C0206682; Follicular thyroid carcinoma C0206698; Cholangiocarcinoma C0221217; Neck webbing C0221353; Horseshoe Kidney C0221354; Frontal bossing C0233315; Premature birth of newborn C0237326; Dyschezia C0238397; Pulmonary artery stenosis C0238463; Papillary thyroid carcinoma C0239234; Low set ears C0239676; High forehead C0240063; Coloboma of iris C0240295; Mandibular hypoplasia C0240635; Byzanthine arch palate C0241074; Skin hyperelastic C0259817; Xerosis C0262444; Dental abnormalities C0263490; Brittle hair C0264886; Conduction disorder of the heart C0265319; Fibrous skin tumor of tuberous sclerosis C0265529; Plagiocephaly C0270921; Axonal neuropathy C0271623; Hypogonadotropic hypogonadism C0277959; Coarse hair C0279680; Transitional cell carcinoma of bladder C0334583; Pilocytic Astrocytoma C0346647; Malignant neoplasm of pancreas C0349588; Short stature C0349639; Juvenile Myelomonocytic Leukemia C0423110; Downward slant of palpebral fissure C0423113; Telecanthus C0423867; Fine hair C0423903; Low intelligence C0426414; Small nose C0431391; Hemimegalencephaly C0431448; Absent eyebrow C0431478; Posteriorly rotated ear C0432123; Interparietal craniosynostosis C0432163; Defect of vertebral segmentation C0432333; Abnormal dermatoglyphic pattern C0521525; Short neck C0521533; Atrial septal aneurysm C0522055; Electrocardiogram abnormal C0541764; Delayed bone age C0544886; Somatic mutation C0546964; Genu recurvatum C0554972; Large auricle C0557874; Global developmental delay C0558165; Curly hair (finding) C0575158; Kyphoscoliosis deformity of spine C0578682; Madarosis of eyebrow C0587248; Costello syndrome (disorder) C0596263; Carcinogenesis C0678222; Breast Carcinoma C0678230; Congenital Epicanthus C0699791; Stomach Carcinoma C0700208; Acquired scoliosis C0744641; Intermittent migraine headaches C0747078; Generalized osteopenia C0855329; Electrocardiogram change C0855740; Abnormal platelet function C0887833; Carcinoma, Pancreatic Ductal C0917816; Mental deficiency C0919267; ovarian neoplasm C1262477; Weight decreased C1263846; Attention deficit hyperactivity disorder C1263857; Peripheral axonal neuropathy C1275081; Cardio-facio-cutaneous syndrome C1306710; Facial asymmetry C1328931; Multiple lentigines C1333990; Hereditary Nonpolyposis Colorectal Cancer C1368816; Sebaceous adenoma C1450010; Plagiocephaly, Nonsynostotic C1458140; Bleeding tendency C1458155; Mammary Neoplasms C1704375; Hypophosphatemic Rickets C1827524; Wide spaced nipples C1832348; Slow-growing hair C1832603; EKG abnormalities C1833752; Varying degree of multiple fractures C1835157; Partial to total absence of eyelashes C1835581; Large protruding ears C1835884; Triangular face C1836047; Long face C1836542; Depressed nasal bridge C1836940; Excess nuchal skin C1837732; Thickened helices C1837760; Prominent eyes C1837770; Sparse hair C1838329; APLASIA CUTIS CONGENITA WITH EPIBULBAR DERMOIDS C1839739; Prominent lower lip C1840077; Anteverted nostril C1842408; Increased risk of pancreatic cancer C1842820; Cardiac conduction abnormalities C1843367; Poor school performance C1844947; Death in early childhood C1845847; Coarse facial features C1846821; Coagulation abnormalities C1848490; Protruding eyes C1848570; Large, floppy ears C1848765; Sparse/absent eyebrows C1849089; Broad forehead C1849265; Overgrowth C1849340; Long palpebral fissure C1850189; Large pinnae C1851731; Generalized overgrowth C1851868; Reduced tensile strength of hair C1853237; Isolated cases C1853242; Midface retrusion C1853737; Prominent occiput C1854114; Short nose C1854418; Biparietal narrowing C1855062; Large dysplastic ears C1855728; Low posterior hairline C1857130; Hypoplastic mandible condyle C1857486; Low-set, posteriorly rotated ears C1857539; Deep palmar crease C1858430; Death in infancy C1860236; Irregular hyperpigmentation C1860245; Cranial asymmetry C1860838; Large prominent ears C1860844; Thin, sparse hair C1860991; NOONAN SYNDROME 3 C1861869; Underdeveloped supraorbital ridges C1861975; Cafe au lait spots, multiple C1862314; Basal cell nevi C1862425; Prominent globes C1862855; Sparse to absent eyelashes C1864897; Cognitive delay C1865014; Long philtrum C1866227; Somatic mosaicism C1866231; Full cheeks C1866934; Decreased to absent deep tendon reflexes C1867873; Failure to thrive in infancy C1956257; Pulmonary Stenosis C1970705; Fragile hair C2051831; Pectus excavatum C2053437; Full lower lip C2239176; Liver carcinoma C2266639; Absence of eyebrows C2673410; Small midface C2674608; Feeding difficulties in infancy C2674723; RAS-ASSOCIATED AUTOIMMUNE LEUKOPROLIFERATIVE DISORDER C2674737; Finger abnormalities C2674738; Toe abnormalities C2677762; Tall forehead C2700617; Irritation - emotion C2748653; Chubby cheeks C2931038; Pancreatic carcinoma, familial C2931822; Nasopharyngeal carcinoma C3150281; Fetal overgrowth C3164374; Abnormality of pulmonary valve C3279222; Cerebellar hypoplasia and atrophy C3489396; Hypogonadism, Isolated Hypogonadotropic C3495559; Juvenile arthritis C3550546; Depressed nasal root/bridge C3551426; Dystrophic fingernails C3551430; Sparse or absent eyebrows C3551431; Sparse or absent eyelashes C3553764; Joint hyperflexibility C3714745; Malabsorption C3714756; Intellectual Disability C3805574; Increased fracture rate C3806283; Frequent fractures C3806443; Puffy cheeks C3809005; CARDIOFACIOCUTANEOUS SYNDROME 2 C3854181; Nevus sebaceous C4020777; Underdeveloped brows C4020875; Mental and motor retardation C4020876; Dull intelligence C4020884; Anxiety disease C4020899; Autosomal recessive predisposition C4020962; Enlarged thorax C4021242; Hypoplasia of the zygomatic bone C4021956; Aplasia/Hypoplasia of the eyebrow C4022012; Death in early adulthood C4022025; Asymmetric growth C4023397; Abnormal hair quantity C4023551; Abnormality of dental color C4023909; Aplasia/Hypoplasia of the abdominal wall musculature C4024878; Generalized hyperpigmentation C4024890; Excessive wrinkled skin C4025662; Abnormality of the ulna C4025749; Abnormality of the spleen C4025846; Abnormality of vision C4072825; Thickened facial skin with coarse facial features C4072830; Asymmetry of the posterior cranium C4072834; Rough hair texture C4072837; Fractured hair C4072879; Small cheekbone C4082173; Porencephaly C4083076; Increased head circumference C4255213; Increased size of skull C4280258; Asymmetry of head C4280269; Noncancerous mole C4280320; Hypotrophic midface C4280321; Decreased projection of midface C4280368; Hypotrophic cheekbone C4280369; Flattening of the zygomatic bone C4280370; Depressed cheekbone C4280495; Concave bridge of nose C4280532; Decreased width of the skull C4280581; Aplasia of eyebrows C4280582; Agenesis of eyebrows C4280597; Rhomboid shaped head C4280598; Flattening of head C4280625; Decreased size of eyeball C4280647; Hypertrophy of cheeks C4280648; Hyperplasia of cheeks C4280652; Prominent back of the head C4280657; Malformation of head shape C4280658; Malformation of cranium shape C4280659; Malformation of cranial vault shape C4280660; Abnormality of head shape C4280661; Abnormality of cranium shape C4280662; Abnormality of cranial vault shape C4280663; Increased size of cranium C4280664; Big calvaria C4280807; Flattening of cranial vault C4280808; Abnormally small eyeball
HGMD (count: 19) (view all)	CM070963; Costello syndrome; Missense/nonsense CM073168; Costello syndrome; Missense/nonsense CM087372; Multiple mole melanoma syndrome; Missense/nonsense CM076251; Cardio-facio-cutaneous syndrome; Missense/nonsense CM061082; Noonan syndrome; Missense/nonsense CM070964; Cardio-facio-cutaneous syndrome; Missense/nonsense CM070966; Noonan syndrome; Missense/nonsense CM070967; Noonan syndrome; Missense/nonsense CM061081; Cardio-facio-cutaneous syndrome; Missense/nonsense CM070968; Noonan syndrome; Missense/nonsense CM070965; Noonan syndrome; Missense/nonsense CM061079; Noonan syndrome; Missense/nonsense CM092327; Noonan syndrome; Missense/nonsense CM061080; Cardio-facio-cutaneous syndrome; Missense/nonsense CM061830; Noonan syndrome; Missense/nonsense CM061083; Noonan syndrome; Missense/nonsense CM070969; Noonan syndrome; Missense/nonsense CM070970; Noonan syndrome; Missense/nonsense CR086338; Lung cancer, risk, association with ; Regulatory

※ PTM Sites

PTM	Modification Sites
Phosphorylation (count: 6)	106 QIKRVKDSEDVPMVL dbPAF 137 AQDLARSYGIPFIET dbPAF 172 QYRLKKISKEEKTPG dbPAF 2 ****MTEYKLVVV dbPAF 4 **MTEYKLVVVGA dbPAF 64 DTAGQEEYSAMRDQY dbPAF
Acetylation (count: 1)	104 REQIKRVKDSEDVPM PLMD
Ubiquitination (count: 3)	117 PMVLVGNKCDLPSRT PLMD 128 PSRTVDTKQAQDLAR PLMD 147 PFIETSAKTRQRVED PLMD

※ Protein-Protein Interaction

Network

Interaction

A

B

Source

P00558	P01116	BioGRID
P01116	P02647	BioGRID
P01116	P04049	HPRD; DIP;IntAct
P01116	P05413	BioGRID
P01116	P10415	HPRD
P01116	P26441	BioGRID
P01116	P30049	BioGRID
P01116	P50748	BioGRID
P01116	P62158	HPRD
P01116	P98160	BioGRID
P01116	Q32M45	BioGRID
P01116	Q7Z6M4	BioGRID
P01116	Q86YJ6	BioGRID
P01116	Q8WZ42	BioGRID
P01116	Q9H2C1	BioGRID